DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and rdh14b

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001040655.1 Gene:rdh14b / 334665 ZFINID:ZDB-GENE-030131-6605 Length:323 Species:Danio rerio


Alignment Length:328 Identity:144/328 - (43%)
Similarity:201/328 - (61%) Gaps:29/328 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 APVFLAHGIVGIIAFCVRLYMQGGKFRKQTDE---------TGKVAIVTGGNTGLGKETVMELAR 67
            |.|.||..:.|.:.|..|..:    ||::...         .||..||||.|.|:||.|..||.:
Zfish     3 AAVVLAAVLGGGVFFIARRII----FRRKALRLMSYPPALMRGKTVIVTGANCGIGKATAAELLK 63

  Fly    68 RGATVYMACRNKEKVERARREIVKETGNS--NVFSRECDLSSLDSIRKFAENFKKEQRVLHILIN 130
            ..|.|.||||::::.|.|.|:|..:.|.|  .:..:..||:||.|:|:|.|...:|:..:.:|||
Zfish    64 LQARVIMACRDRQRAEDAARDIQNQAGTSQGEIVIKHLDLASLQSVRRFCEEVIREEPRIDVLIN 128

  Fly   131 NAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDIN 195
            |||::..|:..|:|||||.|||||:||||||||||.:|::|:|||||||:|:.::.|.|..:|:|
Zfish   129 NAGLYQCPYSKTEEGFEMQLGVNHLGHFLLTNLLLDLLKQSSPSRVVVVSSKLYKYGSINFEDLN 193

  Fly   196 SSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVE 260
            |...|::...|.||||||:|||||||:||:||.||||||.|||..|.:.|::          .:.
Zfish   194 SEQSYNKSFCYSQSKLANLLFTRELARRLDGTEVTVNALTPGIVRTRLGRHV----------NIP 248

  Fly   261 TILRPLLWAV----MKTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWA 321
            .:::||.|.|    .|:|..||||.||.|..|::|.|||:.|::|....:...|.||..|:.||.
Zfish   249 LLIKPLFWLVSWLFFKSPLEGAQTPLYLACSPEVEGVSGKCFANCEEEQLLSKATDDHAAKRLWD 313

  Fly   322 QSE 324
            .||
Zfish   314 LSE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 124/257 (48%)
NADB_Rossmann 45..323 CDD:304358 133/283 (47%)
rdh14bNP_001040655.1 PRK06197 41..322 CDD:235737 135/286 (47%)
NADB_Rossmann 41..315 CDD:304358 133/283 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.