DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and CG31810

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:273 Identity:65/273 - (23%)
Similarity:106/273 - (38%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEIVIRFLQSIAPVFLAHGIVGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMEL 65
            :.||....:::..:|      .||...|..:.:....:...::.|..|:|||...|:|||...||
  Fly    18 LSIVAYLYENLKSLF------SIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYAREL 76

  Fly    66 ARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRV------ 124
            ||:|..:.:..|.:||:.....||..:   .||           .|:....:|.|.:.|      
  Fly    77 ARQGLNLVLVSRKEEKLIAVTNEIGSQ---YNV-----------KIKWIVADFAKGREVYAHIEK 127

  Fly   125 ------LHILINNAGVFWEPHRLTKEGFEM---HLGVNHIGHFLLTNLLLGVLERSAPSRVVVVA 180
                  :.||:||.|...:|..|.|...:|   .|.||.....:||..:|       |..:    
  Fly   128 ELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKIL-------PQMI---- 181

  Fly   181 SRAHERGQIKVDDINSSDF--YDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIADTEI 243
              :..:|.| |:..:||:.  :....||..:|.....||:.|...:....:.|..:.|..    :
  Fly   182 --SRRKGAI-VNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAF----V 239

  Fly   244 ARNMIFFQTKFAQ 256
            |.||..:..|..|
  Fly   240 ATNMNSYSDKVRQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 59/230 (26%)
NADB_Rossmann 45..323 CDD:304358 59/229 (26%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 65/273 (24%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 59/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.