DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Ldsdh1

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster


Alignment Length:245 Identity:64/245 - (26%)
Similarity:113/245 - (46%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IVGIIAFCVRLYMQ-----GGKFRKQ--TDETGKVAIVTGGNTGLGKETVMELARRGATVYMACR 77
            :|.|:...|:.::.     .|.||..  .|..|||.::||...|:|||..::.|:.|||:.....
  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDV 90

  Fly    78 NKEKVERARREIVKETGNS--NVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEP-H 139
            |    |:...:.|||..|:  ..|...|:::..:.:.:.|:..:||...:|:::||||:.  | |
  Fly    91 N----EQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIM--PCH 149

  Fly   140 RL---TKEGFEMHLGVNHIGHF-LLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFY 200
            .|   |:....:...:|.:.|| ::...|..::||:..| :|.::|.|...|.|.:         
  Fly   150 PLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGS-IVALSSCAGLFGLINL--------- 204

  Fly   201 DEGVAYCQSKLA----NILFTRELAKRLEGTGVTVNALNPGIADTEIARN 246
               |.||.:|.|    ......||.::.....|.:..:.|.:.||.:.:|
  Fly   205 ---VPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 57/214 (27%)
NADB_Rossmann 45..323 CDD:304358 57/213 (27%)
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 55/207 (27%)
NADB_Rossmann 60..287 CDD:304358 55/211 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.