DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and spidey

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:273 Identity:64/273 - (23%)
Similarity:97/273 - (35%) Gaps:85/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAHGIVGIIAF-----CVRLYMQGGK-FRKQTD--ETGKVAIVTGGNTGLGKETVMELARRGATV 72
            ||.||||...|     .:...:.|.| |....|  :.|:.|:|||...|:||....||||||..:
  Fly    15 LAIGIVGFQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLKL 79

  Fly    73 YMACRNKEKVERARREI------------VKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVL 125
            .:..|:.||:....:||            |..||...::         |.||:     |.....:
  Fly    80 VLISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIY---------DKIRE-----KTTGLNV 130

  Fly   126 HILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAH------ 184
            .:|:||.|:.:                   ||   ....|...:...|....:||:..|      
  Fly   131 GVLVNNVGISY-------------------GH---PEYFLDCYKADPPFLRNIVAANIHSVTHMT 173

  Fly   185 ----------ERGQIKVDDINSSDFYDEGV-------AYCQSKLANILFTRELAKRLEGTGVTVN 232
                      .||.|    ||.|.  ..||       .|..:|.....|:.:|....:..|:.:.
  Fly   174 ALFLPGMISQRRGVI----INVSS--TAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQ 232

  Fly   233 ALNPGIADTEIAR 245
            ::.||...|.:::
  Fly   233 SVQPGFVATNMSK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 53/237 (22%)
NADB_Rossmann 45..323 CDD:304358 53/236 (22%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 64/273 (23%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 53/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.