DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and CG3842

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:318 Identity:159/318 - (50%)
Similarity:202/318 - (63%) Gaps:17/318 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFLAHGIVGIIAF--CVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMAC 76
            :||.  ::||:.|  .:|..:||..:||.....|||.||||.|||:|||||:|||:|||.|||||
  Fly    43 IFLI--VLGILLFMWLLRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMAC 105

  Fly    77 RNKEKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRL 141
            |:..:.|.||.:|:..:.|..:|:|..||.||.|:|.|.|.||.|:..|.||||||||...|..|
  Fly   106 RDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTL 170

  Fly   142 TKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDI----NSSDFYDE 202
            |.:|||...||||:||||||||||..|:.|:|||:|||:|.||..|:|..:|:    |.|.|:. 
  Fly   171 TADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFG- 234

  Fly   203 GVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLL 267
              ||.||||||||||.:|:..|:.||||||..:||:..|||.|:.      .....::|.|:...
  Fly   235 --AYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHF------SGPGWMKTALQKGS 291

  Fly   268 WAVMKTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWAQSEK 325
            ....||||.||||.|..||||.||..:|.|:|||...|:.|...:.|.|.|||.:|||
  Fly   292 LYFFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 134/255 (53%)
NADB_Rossmann 45..323 CDD:304358 146/281 (52%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 134/256 (52%)
NADB_Rossmann 74..347 CDD:304358 146/281 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448978
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm14703
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
1110.800

Return to query results.
Submit another query.