DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Rdh12

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001101507.1 Gene:Rdh12 / 314264 RGDID:1310462 Length:316 Species:Rattus norvegicus


Alignment Length:297 Identity:148/297 - (49%)
Similarity:189/297 - (63%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKE 92
            :|.:..||....:....|||.::||.|||:||||..|||||||.||:|||:..|.|.|..||..:
  Rat    22 IRKFFAGGVCTTKVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRAD 86

  Fly    93 TGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGH 157
            |.||.|..|:.|||...|||.|||.|..|::.||||||||||...|:..|.:|||.|.||||:||
  Rat    87 TKNSQVLVRKLDLSDTKSIRTFAEGFLAEEKKLHILINNAGVMMCPYSKTVDGFETHFGVNHLGH 151

  Fly   158 FLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAK 222
            ||||.||||.|:.|||:||:.::|.||..|:|:..|:.|...|..|.||..|||||:||||||||
  Rat   152 FLLTYLLLGRLKESAPARVINLSSVAHLGGKIRFHDLQSKKRYCSGFAYSHSKLANVLFTRELAK 216

  Fly   223 RLEGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWAV----MKTPKNGAQTTLY 283
            ||:|||||...::||...:||.|:              :.|..|||.:    .|:|..||||:|:
  Rat   217 RLQGTGVTAYVVHPGCVLSEITRH--------------SFLMCLLWRLFSPFFKSPWQGAQTSLH 267

  Fly   284 AALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLW 320
            .||:..||.:||:|||||....|:|.|.:.:.|:.||
  Rat   268 CALEEGLEPLSGKYFSDCKRTWVSPRARNKKTAERLW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 133/255 (52%)
NADB_Rossmann 45..323 CDD:304358 145/280 (52%)
Rdh12NP_001101507.1 NADB_Rossmann 39..307 CDD:419666 145/280 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm45462
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.