DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Cbr3

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:292 Identity:78/292 - (26%)
Similarity:124/292 - (42%) Gaps:63/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVAIVTGGNTGLGKETVMELARR-GATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            :||:|||.|.|:|.....:|.|: ...|.:..|::.:...|.:::..| |.|..| .:.|:.:..
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAE-GLSPRF-HQLDIDNPQ 68

  Fly   110 SIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLT-NLLLGVLERSAP 173
            |||...:..:||...|::|:||||:.:.....|.  |::...|....:|..| |:...:|....|
  Rat    69 SIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTP--FDVQAEVTLKTNFFATRNVCTELLPIMKP 131

  Fly   174 -SRVVVVAS----RAHE------RGQIKVDDINSSDFYD----------------EG---VAYCQ 208
             .|||.|:|    :|.|      :.:.:.|.:...|..|                ||   .||..
  Rat   132 HGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDSAYGV 196

  Fly   209 SKLANILFTRELAKRLE----GTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWA 269
            |||...:.||.||::|:    ...:.:||..||...|::||:.                      
  Rat   197 SKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQ---------------------- 239

  Fly   270 VMKTPKNGAQTTLY-AALDPDLERVSGQYFSD 300
            ..:|.:.||:|.:| |.|.||.....||...|
  Rat   240 GSRTVEEGAETPVYLALLPPDATEPHGQLVRD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 75/286 (26%)
NADB_Rossmann 45..323 CDD:304358 78/292 (27%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 78/292 (27%)
adh_short 6..241 CDD:278532 66/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.