DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:291 Identity:132/291 - (45%)
Similarity:183/291 - (62%) Gaps:23/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            |:.|:|||.|:|:||.|.:|||||||.|.:|||::|:.|.|..::.:|:||:.|.....||:||.
  Rat    36 GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLT 100

  Fly   110 SIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPS 174
            |::.||..|...:..|.|||:|||:  .....|:|.|.:.|.|||:|.||||:|||..|...|||
  Rat   101 SVQAFATAFLSSEPRLDILIHNAGI--SSCGRTRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPS 163

  Fly   175 RVVVVASRAHERGQIKVDDINSSD-----FYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNAL 234
            |||:|:|.||.||::   |....|     :..|..||..|||||:||.||||.:|||||||..|.
  Rat   164 RVVIVSSAAHRRGRL---DFTRLDCPVVGWQQELRAYADSKLANVLFARELATQLEGTGVTCYAA 225

  Fly   235 NPGIADTEIARNMIFFQTKFAQYV---VETILRPLLWAVMKTPKNGAQTTLYAALDPDLERVSGQ 296
            :||..::|:          |.:::   :..|||||.|.|::.|:.||||.||.||...:|.:||:
  Rat   226 HPGPVNSEL----------FLRHLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGR 280

  Fly   297 YFSDCALAPVAPAALDDQMAQWLWAQSEKWA 327
            ||::|.:..|:.||.|||.|..||..::|.|
  Rat   281 YFANCHVEEVSAAARDDQAAHRLWKVTKKLA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 117/258 (45%)
NADB_Rossmann 45..323 CDD:304358 130/285 (46%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 128/282 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.