DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Cbr1

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_062043.1 Gene:Cbr1 / 29224 RGDID:2286 Length:277 Species:Rattus norvegicus


Alignment Length:299 Identity:72/299 - (24%)
Similarity:120/299 - (40%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VAIVTGGNTGLGKETVMELARRG-ATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDS 110
            ||:|||.|.|:|...|.:|.|:. ..|.:..|::.:...|.:::..| |.|..| .:.|:.:..|
  Rat     7 VALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTE-GLSPRF-HQLDIDNPQS 69

  Fly   111 IRKFAENFKKEQRVLHILINNAGVFWE-----PHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLER 170
            ||...:...:|...|::|:||||:.::     |..:..   |:.:..|..|...:...||.::: 
  Rat    70 IRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQA---EVTMKTNFFGTQDVCKELLPIIK- 130

  Fly   171 SAPSRVVVVASRAHERG--------QIK------------------VDDINSSDFYDEG---VAY 206
             ...|||.|:|....|.        |.|                  ::|........||   .||
  Rat   131 -PQGRVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPNSAY 194

  Fly   207 CQSKLANILFTRELAKRL----EGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLL 267
            ..:|:...:.:|..|::|    ....:.:||..||...|::|..                     
  Rat   195 GVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDMAGP--------------------- 238

  Fly   268 WAVMKTPKNGAQTTLY-AALDPDLERVSGQYFSDCALAP 305
             ...|:|:.||:|.:| |.|.|..|...||:..|..:.|
  Rat   239 -KATKSPEEGAETPVYLALLPPGAEGPHGQFVQDKKVEP 276

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 68/288 (24%)
NADB_Rossmann 45..323 CDD:304358 72/299 (24%)
Cbr1NP_062043.1 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 72/299 (24%)
adh_short 7..239 CDD:278532 58/260 (22%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 0/1 (0%)