DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_006249055.1 Gene:Dhrsx / 288525 RGDID:1305017 Length:331 Species:Rattus norvegicus


Alignment Length:317 Identity:124/317 - (39%)
Similarity:166/317 - (52%) Gaps:26/317 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGIIAFCVRLY--MQGGKFRK-----QTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRN 78
            ||:....|:|.  ::|| ||.     |.|   :||||||...|:|..|..:|||.|..|.:|..:
  Rat    14 VGVAVTMVQLLRRLRGG-FRPPELPLQAD---RVAIVTGATRGVGLSTACQLARLGMRVIVAGND 74

  Fly    79 KEKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTK 143
            :.:.......|.:|:|..:......||:||.|:|.|..||:.....||:|||||||..:|...||
  Rat    75 EHRGHEVVARIQEESGPESAHFLFLDLASLSSVRSFVRNFEATALPLHLLINNAGVMLDPSGNTK 139

  Fly   144 EGFEMHLGVNHIGHFLLTNLLLGVLERSA----PSRVVVVASRAHERGQIKVDD-INSSDFYDEG 203
            :|||.|:|||.:||||||:|||..|..|.    .|||:.|.|..|..||..|.. :..|......
  Rat   140 DGFERHVGVNFLGHFLLTSLLLPALRASGHQGRKSRVITVCSSTHWVGQADVARLLGQSPAPCAL 204

  Fly   204 VAYCQSKLANILFTRELAKRLEGTG--VTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPL 266
            .||..||||..||:..|.:.|...|  ||.|.::||:.||.:..:        |.:....:.|.|
  Rat   205 AAYAGSKLALALFSLRLQRLLSALGDPVTANIVDPGVVDTALFAH--------AGWGTRAVQRFL 261

  Fly   267 LWAVMKTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWAQS 323
            .|.:.|||..||.|::|||..|.||.:.|:|..|.|.|.|..||.|.::...|||:|
  Rat   262 GWLLFKTPDEGAWTSVYAAASPKLEGIGGRYLRDEAEAEVLGAARDLELQGHLWAES 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 101/258 (39%)
NADB_Rossmann 45..323 CDD:304358 113/284 (40%)
DhrsxXP_006249055.1 PRK06197 36..326 CDD:235737 116/294 (39%)
NADB_Rossmann 41..315 CDD:304358 111/284 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.