DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and DC2.5

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_503155.4 Gene:DC2.5 / 183970 WormBaseID:WBGene00017082 Length:337 Species:Caenorhabditis elegans


Alignment Length:314 Identity:99/314 - (31%)
Similarity:160/314 - (50%) Gaps:36/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFRKQT---------DETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVK 91
            ||..:|         |.:||...:||..:|:|.||......:||.:.|..||....|..::.::.
 Worm    27 KFHSRTNALEVVRGIDLSGKTYAITGTTSGVGTETARAFILKGAHIVMINRNYAASETLKQSLLC 91

  Fly    92 ETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIG 156
            ||.::.:...:||||||.|::|.||.:..::..||.||.||||.....:.|.:.||.|.|:||:.
 Worm    92 ETPDARIDIVQCDLSSLASVKKTAEEYLTKKWPLHGLILNAGVLGRKEKTTADRFEAHFGINHLA 156

  Fly   157 HFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDD-----------INSSDFYDEGVAYCQSK 210
            ||||...||.||..|||||:|:::|...:...|..|.           .|::::|..  .|.:||
 Worm   157 HFLLIKELLPVLRSSAPSRIVILSSTLSKFTSINPDSKIEEKLGTLCPKNATEWYYR--LYAKSK 219

  Fly   211 LANILFTRELAKRLEGTGVTVNALNPGIA-DTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTP 274
            :.|:|...:|.:.....|::|.:::||.| .|.:.|::.|:          :|...|.....|..
 Worm   220 MCNMLIAFKLHRDEFENGISVYSVHPGSAVRTNLHRDVPFW----------SIFNFLSIPFTKNA 274

  Fly   275 KNGAQTTLYAALDPDLERVSGQYFSDC---ALAPVAPAALDDQMAQWLWAQSEK 325
            ..||.|:||.|:.|:::.:||:|:..|   .|......|.|:::.:.||..||:
 Worm   275 SQGAATSLYCAVHPEVQELSGRYWESCWDDELNLDEKVARDEELQEALWEYSEE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 85/263 (32%)
NADB_Rossmann 45..323 CDD:304358 93/292 (32%)
DC2.5NP_503155.4 PRK06196 28..331 CDD:235736 98/313 (31%)
retinol-DH_like_SDR_c_like 45..323 CDD:212492 91/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.