DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and dhs-17

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001041109.1 Gene:dhs-17 / 178990 WormBaseID:WBGene00000980 Length:286 Species:Caenorhabditis elegans


Alignment Length:314 Identity:87/314 - (27%)
Similarity:135/314 - (42%) Gaps:75/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVAIVTGGNTGLGKETVMELARRGAT-VYMACRNKEKVERARREIVKETGN-SNVFSRECDLSSL 108
            :..::||...|:||:|.::||..... |.:..|.:||....:..|.||.|| ||:.....|.:.|
 Worm     8 RTILITGATDGIGKQTALDLAAHPDNFVIIHGRTEEKCIATKDWIGKENGNCSNIDYVAGDFAVL 72

  Fly   109 DSIRKFAENFKKEQRVLHILINNAGVFWEPHRL-TKEGFEMHLGVNHIGHFLLTNLLLGVLERSA 172
            ..:...||..::....|::|:.||||.: |.|| ||:|.|....||::.|:||.||||.||..:.
 Worm    73 KEVAIIAEEVERRFPELNVLLCNAGVLY-PRRLETKDGMESTFQVNYLAHYLLCNLLLPVLSHNR 136

  Fly   173 PSRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPG 237
             |.|:||.|..|....:...|:.::..|::.:.|.:|||...|....|.:|:             
 Worm   137 -SNVIVVGSVLHTWPSLDWADVMATKEYEKYLQYSRSKLMCHLMAFALHRRM------------- 187

  Fly   238 IADTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALD--------------- 287
                .|||          |:|...|:.   ....|.|.|..:....:||.               
 Worm   188 ----NIAR----------QHVNVNIIE---LGKEKEPNNNGKLRTTSALSSSMSTLSICRQAGNL 235

  Fly   288 ------PDLERVSGQYF----------SDCALAPVAPAALDDQMAQWLWAQSEK 325
                  |.||::||:|.          ||         |.|:::.:.|||.|::
 Worm   236 AQLIEGPCLEKISGKYLDPSGKQMRSGSD---------ATDERLQERLWAYSKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 77/273 (28%)
NADB_Rossmann 45..323 CDD:304358 86/310 (28%)
dhs-17NP_001041109.1 retinol-DH_like_SDR_c_like 7..275 CDD:212492 83/307 (27%)
PRK06197 8..281 CDD:235737 87/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.