DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and LOC102556347

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_006248171.2 Gene:LOC102556347 / 102556347 RGDID:7631561 Length:329 Species:Rattus norvegicus


Alignment Length:299 Identity:71/299 - (23%)
Similarity:119/299 - (39%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VAIVTGGNTGLGKETVMELARRG-ATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDS 110
            ||:|||.|.|:|...|.:|.|:. ..|.:..|::.:...|.:::..| |.|..| .:.|:.:..|
  Rat    59 VALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTE-GLSPRF-HQLDIDNPQS 121

  Fly   111 IRKFAENFKKEQRVLHILINNAGVFWE-----PHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLER 170
            ||...:...:|...|::|:||||:.::     |..:..   |:.:..|..|...:...||.::: 
  Rat   122 IRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQA---EVTMKTNFFGTQDVCKELLPIIK- 182

  Fly   171 SAPSRVVVVASRAHERG--------QIK------------------VDDINSSDFYDEG---VAY 206
             ...|||.|:|....|.        |.|                  ::|........||   .||
  Rat   183 -PQGRVVNVSSGMSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPNSAY 246

  Fly   207 CQSKLANILFTRELAKRL----EGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLL 267
            ..:|:...:.:|..|::|    ....:.:||..||...|::...                     
  Rat   247 GVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDMTGP--------------------- 290

  Fly   268 WAVMKTPKNGAQTTLYAALDPD-LERVSGQYFSDCALAP 305
             ...|:|:.||:|.:|.||.|. .|...||:..|..:.|
  Rat   291 -EATKSPEEGAETPVYLALLPSGAEGPHGQFVQDKKVEP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 67/288 (23%)
NADB_Rossmann 45..323 CDD:304358 71/299 (24%)
LOC102556347XP_006248171.2 carb_red_PTCR-like_SDR_c 59..329 CDD:187585 71/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.