DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and dhrsx

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_002933664.3 Gene:dhrsx / 100487450 XenbaseID:XB-GENE-5952439 Length:327 Species:Xenopus tropicalis


Alignment Length:293 Identity:109/293 - (37%)
Similarity:168/293 - (57%) Gaps:14/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSS 107
            :.|||||||||..|:|..|...|:..|..|.:|..|:.:...|...|.::|.|..|....|||:|
 Frog    39 QNGKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYCDLAS 103

  Fly   108 LDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSA 172
            :.|||:|.:.||.:...||:|:|||||...|.|.|.:|||.|.|:|::||||||||||...:.|.
 Frog   104 MKSIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTADGFEEHFGLNYLGHFLLTNLLLKTTKESG 168

  Fly   173 P----SRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRL--EGTGVTV 231
            .    :|::.|:|..|..|::..||:|||..|....||.|||||.::||..|.::|  :|..||.
 Frog   169 TENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTA 233

  Fly   232 NALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALDPDLERVSGQ 296
            |.::||:.:|::.|| :.:..:..:::...:.       .||.:.||.|::||::.|:||.:.|.
 Frog   234 NVVDPGVVNTDLYRN-VCWPGRLVKWMAARLF-------FKTAEEGAATSIYASVAPELEGIGGC 290

  Fly   297 YFSDCALAPVAPAALDDQMAQWLWAQSEKWAKI 329
            |..:......|..:.::.:.:.||.:|.|...|
 Frog   291 YLYNGQKTKSADISYNEDLQRKLWNESCKMVGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 101/257 (39%)
NADB_Rossmann 45..323 CDD:304358 106/283 (37%)
dhrsxXP_002933664.3 retinol-DH_like_SDR_c_like 41..314 CDD:212492 104/280 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.