DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq9 and COQ9

DIOPT Version :9

Sequence 1:NP_724594.1 Gene:Coq9 / 246650 FlyBaseID:FBgn0050493 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_064708.1 Gene:COQ9 / 57017 HGNCID:25302 Length:318 Species:Homo sapiens


Alignment Length:313 Identity:101/313 - (32%)
Similarity:163/313 - (52%) Gaps:23/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLAPLQPRPLT----FLIARSYGKDEKKANLEDFRAREEQRER------ERDAADQAAEKASQKE 80
            ||..|:..|:.    .|:.|::     .|:....|:.:||:::      ::.:..|.|||...:.
Human    16 RLLQLRCLPVARCRQALVPRAF-----HASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPES 75

  Fly    81 AGGGGGLGAKGSESTGPEDDAKQAKVDAIRAKILDAALQHVPQQGWTRQAIILGAEESGYPSVVH 145
            :........:|.|.   |:|.:..  :.::.:||.|||:.||..|||.:||..||:..|..|...
Human    76 SHSPPRYTDQGGEE---EEDYESE--EQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAA 135

  Fly   146 GMFPEGGFALVSHFNGKCNAQL---VESLQQKTDGGKQEVEDPLDFLVQAVRQRLEMVTPYKTHW 207
            .||.:.|..|:.||..:||.:|   :|..|:....|:.|......||..||..||.|:.||..||
Human   136 SMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHW 200

  Fly   208 PQAMALLAQPQHAPTALAQVLTLVDDICYYSGDRSVDFGWYTRRVGLATIMKMTELYFLQDKSPG 272
            |:|:::|..|.:.|::|:.:.::|||:.:|:||:|.||.|||||..||.|...|||..:||.||.
Human   201 PRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPD 265

  Fly   273 HAQTWEFLKSRMDEAVQLQMMLSQTEGMTHTFQRSFNSAFITARNILGLGYNR 325
            ...||.||::|:::|:.:.....|.:.......:....|.:|.:|:.||...|
Human   266 FEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq9NP_724594.1 diverge_rpsU 110..297 CDD:274110 76/189 (40%)
COQ9 217..287 CDD:285683 32/69 (46%)
COQ9NP_064708.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..98 11/58 (19%)
COQ9 102..281 CDD:419797 75/178 (42%)
Lipid binding. /evidence=ECO:0000269|PubMed:25339443, ECO:0007744|PDB:4RHP 241..244 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147354
Domainoid 1 1.000 83 1.000 Domainoid score I8373
eggNOG 1 0.900 - - E1_COG5590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6477
Inparanoid 1 1.050 166 1.000 Inparanoid score I4176
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55764
OrthoDB 1 1.010 - - D1304924at2759
OrthoFinder 1 1.000 - - FOG0006412
OrthoInspector 1 1.000 - - oto90027
orthoMCL 1 0.900 - - OOG6_104041
Panther 1 1.100 - - LDO PTHR21427
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2073
SonicParanoid 1 1.000 - - X4676
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.