DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq9 and coq9

DIOPT Version :9

Sequence 1:NP_724594.1 Gene:Coq9 / 246650 FlyBaseID:FBgn0050493 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_594426.1 Gene:coq9 / 2542605 PomBaseID:SPAC19G12.11 Length:250 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:65/210 - (30%)
Similarity:107/210 - (50%) Gaps:21/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LGAKGSESTGPEDDAKQAKVDAIRAKILDAALQHVPQQGWTRQAIILGAEESGYPSVVHGMFPEG 151
            ||.:|..|    ::.:.:|:...:|.||:.||:||||.|:|..||:.|.:..||.::...:||.|
pombe    29 LGRRGYHS----ENYETSKISGKKALILENALEHVPQLGFTEDAIVQGGQALGYSNLSKALFPSG 89

  Fly   152 GFALVSHFNGKCNAQLVESLQ------QKTDGGKQEVEDPLDFLVQAVRQRLEMVTPYKTHWPQA 210
            ...|:|:|..| ....:.||:      .:|.|.          :||.:..||:.......|.||.
pombe    90 PMDLISYFFLK-QRYALSSLKPHLTTIPETSGR----------VVQLIWSRLQGNRDIVQHLPQM 143

  Fly   211 MALLAQPQHAPTALAQVLTLVDDICYYSGDRSVDFGWYTRRVGLATIMKMTELYFLQDKSPGHAQ 275
            :|:...|.:...:|:.:..|.|:|.|.:.|:|.||.|||:|..::.|...:||:..:|.||....
pombe   144 IAICTYPSNLRKSLSSLAELSDEILYLAQDKSADFQWYTKRAAISAIYSASELFMSRDTSPNFEA 208

  Fly   276 TWEFLKSRMDEAVQL 290
            |:.|::.|:..|..|
pombe   209 TYNFVQHRIQHAKAL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq9NP_724594.1 diverge_rpsU 110..297 CDD:274110 60/187 (32%)
COQ9 217..287 CDD:285683 23/69 (33%)
coq9NP_594426.1 COG5590 17..247 CDD:227877 65/210 (31%)
diverge_rpsU 48..230 CDD:274110 60/187 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3162
eggNOG 1 0.900 - - E1_COG5590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6477
Inparanoid 1 1.050 106 1.000 Inparanoid score I1606
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006412
OrthoInspector 1 1.000 - - oto101277
orthoMCL 1 0.900 - - OOG6_104041
Panther 1 1.100 - - LDO PTHR21427
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2073
SonicParanoid 1 1.000 - - X4676
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.