DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and CYP735A1

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:451 Identity:105/451 - (23%)
Similarity:194/451 - (43%) Gaps:75/451 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AMRKRYGDIYVMPGMFGRKDWVTT------FNTKDI-EMVFRNEGI----WPRRDGLDSIVYFRE 127
            |..|:||..:::        |..|      ..|:.| |::.::.|:    |.::.|..:.:    
plant    88 AWSKQYGKRFIV--------WNGTDPRLCLTETELIKELLMKHNGVSGRSWLQQQGTKNFI---- 140

  Fly   128 HVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERI-KEIRD-PK 190
                     .:||:.:..:.|...|....|.|...| |:.|...:....::.:||: ||:.: ..
plant   141 ---------GRGLLMANGQDWHHQRHLAAPAFTGER-LKGYARHMVECTSKLVERLRKEVGEGAN 195

  Fly   191 TLEVPEDF----TDEISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQ 251
            .:|:.|:.    .|.|||..|.|    :|:       |.::..:.||:.|  |...:.|..|...
plant   196 EVEIGEEMHKLTADIISRTKFGS----SFE-------KGKELFNHLTVLQ--RRCAQATRHLCFP 247

  Fly   252 PSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRRQAGEKINSNSMLERLMEIDP---- 312
            .|  :.:.:...|::|....:...:..::::..:|..|..|.:....:...:|...|:||.    
plant   248 GS--RFLPSKYNREIKSLKKEVERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDIDKNNNN 310

  Fly   313 ---KVAVIMS--LDILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMK 372
               .:.:||.  ....|||.:.||.||:...:.|:.:|..|.|:|||:..:. .::.|.:.:.:.
plant   311 NNNNLQLIMDECKTFFFAGHETTALLLTWTTMLLADNPTWQEKVREEVREVF-GRNGLPSVDQLS 374

  Fly   373 DMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVPKGTTVLLGSNVLM---KEATYYPRPDE 434
            .:..|..||.|:||.||......|....|:.|....:|||.::.:  .||.   .|..:....::
plant   375 KLTSLSKVINESLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWI--PVLAIHHSEELWGKDANQ 437

  Fly   435 FLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRD 495
            |.|||:      |.:...|...|:||..|||.|||::...:|.:..:|.||..|:...:::
plant   438 FNPERF------GGRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISKN 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 105/451 (23%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 105/451 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.