DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and CYP705A1

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_193268.3 Gene:CYP705A1 / 827199 AraportID:AT4G15330 Length:513 Species:Arabidopsis thaliana


Alignment Length:429 Identity:104/429 - (24%)
Similarity:181/429 - (42%) Gaps:94/429 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DSIVY--FREHVRPDV---------------YGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRM 167
            ||:.|  ||:|   ||               :|....:.|...:.|..::..|....:.|     
plant    89 DSLAYEIFRDH---DVNVSSRGVGAIDESLAFGSSGFIQAPYGDYWKFMKKLIATKLLGP----- 145

  Fly   168 YYEPL---SNINNEFIERI-KEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKNRDN 228
              :||   .:..:|.:||. |.:.|....:.......|.||.|..||..:...|...:     :|
plant   146 --QPLVRSQDFRSEELERFYKRLFDKAMKKESVMIHKEASRFVNNSLYKMCTGRSFSV-----EN 203

  Fly   229 SDALTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRRQ 293
            ::...:.:.:.|:..|:.|..:.             ||.|.|.:.|.::   |.:.:..:..|| 
plant   204 NEVERIMELTADLGALSQKFFVS-------------KMFRKLLEKLGIS---LFKTEIMVVSRR- 251

  Fly   294 AGEKINSNSMLER-LMEIDPKV---------------------------AVIMSL--DILFAGVD 328
                  .:.::|| |:|.:.|:                           :.|.||  :......|
plant   252 ------FSELVERILIEYEEKMDGHQGTQFMDALLAAYRDENTEYKITRSHIKSLLTEFFIGAAD 310

  Fly   329 ATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGLG 393
            |::..:...:..:..:.:...|||||:.|:: .|..|:.|.::.::|||:||:||.||.:|....
plant   311 ASSIAIQWAMADIINNREILEKLREEIDSVV-GKTRLVQETDLPNLPYLQAVVKEGLRLHPPTPL 374

  Fly   394 TMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLR--DPETGKKMQVSPFT 456
            .:|..|....:.|:.|||.||:::.|..:|::...:..||||.|||:|.  ..|..||.::  ..
plant   375 VVREFQEGCEIGGFFVPKNTTLIVNSYAMMRDPDSWQDPDEFKPERFLASLSREEDKKEKI--LN 437

  Fly   457 FLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRD 495
            |||||.|.|||.|..:..:.:.|.:..:::.|..|.|.|
plant   438 FLPFGSGRRMCPGSNLGYIFVGTAIGMMVQCFDWEINGD 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 104/429 (24%)
CYP705A1NP_193268.3 CYP93 71..499 CDD:410748 104/429 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.