DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and CYP709B2

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:426 Identity:96/426 - (22%)
Similarity:168/426 - (39%) Gaps:70/426 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DSIVYF-REHVRPDVYG-EVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNIN-NEFIE 181
            :..|:| :...:|::.. ...||:......|.:.|..:||.|...: |::..:.:.:.. ..|:|
plant   177 NKFVFFSKSKTKPEILKLSGNGLIFVNGLDWVRHRRILNPAFSMDK-LKLMTQLMVDCTFRMFLE 240

  Fly   182 RIKEIRDPKTLEVPEDF---TDEISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFR 243
            ..|:....:|    |.|   :.|..||..:.:...||         ....::.:.:|::..::.:
plant   241 WKKQRNGVET----EQFVLISREFKRLTADIIATAAF---------GSSYAEGIEVFKSQLELQK 292

  Fly   244 -----LT------------------FKLD--IQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKE 283
                 ||                  :|||  :..|:.:||......:.|...||.|.:.......
plant   293 CCAAALTDLYFPGIQYLPTPSNLQIWKLDMKVNSSIKRIIDARLTSESKDYGNDLLGIMLTAASS 357

  Fly   284 NQDALEKRRQAGEKINSNSMLERLMEIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQ 348
            |:.                  |:.|.||..:....:  ..|||.:.||.||:...:.||.|.|.|
plant   358 NES------------------EKKMSIDEIIEECKT--FFFAGHETTANLLTWSTMLLSLHQDWQ 402

  Fly   349 AKLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVPKGT 413
            .|||||:.:.. .||.:.:.|....:..:..|..|:||.|...|..:|....|:.|....:||||
plant   403 EKLREEVFNEC-GKDKIPDAETCSKLKLMNTVFMESLRLYGPVLNLLRLASEDMKLGNLEIPKGT 466

  Fly   414 TVLLG-SNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEM 477
            |::|. :.:...:|.:....|:|.|.|:.........   .|...|.|..|||.|||:....:|.
plant   467 TIILPIAKMHRDKAVWGSDADKFNPMRFANGLSRAAN---HPNALLAFSMGPRACIGQNFAIMEA 528

  Fly   478 ETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFP 513
            :|.:|.:::.|.:..:.|..........::|....|
plant   529 KTVLAMILQRFRLNLSADYKHAPADHLTLQPQYDLP 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 94/419 (22%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 96/426 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.