DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and Cyp6d5

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster


Alignment Length:394 Identity:107/394 - (27%)
Similarity:180/394 - (45%) Gaps:65/394 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERIKE---IRDPKTLEVPEDFT-- 199
            |...:..:|..||:.:.|.|...: |:..:|...::.::.::.|::   ....|.||:.:...  
  Fly   115 LFQMEGASWRALRNKLTPSFTSGK-LKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMATY 178

  Fly   200 --DEISRLVFESLGLVAF---DRQMGLIRK--NRDNSDALTLFQTSRDIFRLTFKLDIQPSM--- 254
              |.|:..:| .|.:.:|   :.:..:|.|  ||:|.:         ||.|.|... :.|.:   
  Fly   179 AIDIIATTIF-GLDVDSFADPNNEFQIISKKVNRNNIE---------DIIRGTSSF-LYPGLEKF 232

  Fly   255 -----WKIISTPTYRKM-KRT--LNDSLNVAQKMLKENQDALEKRRQAGEKINSNSMLERLMEID 311
                 ||..:|...|:: .||  |.:..|:.:|.|.  |..|:.|.|.  |||::..:.. .|..
  Fly   233 FVKIGWKQEATERMRELSNRTVDLREQNNIVRKDLL--QLLLQLRNQG--KINTDDNIWS-AEST 292

  Fly   312 PKVAVIMSLDIL--------FAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNE 368
            ......||.|::        .||.:.||:..|..|..|:::|:...|.:|::.|.:......|..
  Fly   293 KNGVKSMSKDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTY 357

  Fly   369 ENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVP-------KGTTVLLGSNVLMKEA 426
            :.:.||.||.|.|.||.|.||......|.|..|     |.||       |||.:::....:.::.
  Fly   358 DAISDMKYLEACILETARKYPALPLLNRICTKD-----YPVPDSKLVIQKGTPIIISLIGMHRDE 417

  Fly   427 TYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVE 491
            .|:|.|..:.|||:|   |.||  ..:...:||||.|||||||.|:..:.::..:||::.||.:|
  Fly   418 EYFPDPLAYKPERYL---ENGK--DYTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLE 477

  Fly   492 FNRD 495
            ..::
  Fly   478 IRKE 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 107/394 (27%)
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 106/389 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.