DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and Cyp313a4

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_650224.3 Gene:Cyp313a4 / 41563 FlyBaseID:FBgn0038076 Length:494 Species:Drosophila melanogaster


Alignment Length:405 Identity:95/405 - (23%)
Similarity:177/405 - (43%) Gaps:61/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNE---FIERIKEIRDPKTLEVPEDFTD 200
            ||.:.::..|...|..:||.|    |.::....|...|.|   .:::::.::|       :...|
  Fly   112 GLFSLKDPRWSIHRKLLNPAF----GHKVLLSFLPIFNRETALLLDQLEPLQD-------DGEKD 165

  Fly   201 EISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQPSMW-------KII 258
            .|..|...:|| :|....||...|:.::..:.:|....:.|  |....|:..|.|       ::.
  Fly   166 LIPLLQSFTLG-IATQTTMGSDVKDEESFRSNSLLGRYQCI--LETMTDMCFSPWLNSRFCRQLA 227

  Fly   259 STPT-YRKMKRTLNDSLN--VAQKMLKENQDALEKRRQAGEKINSNSMLERLMEIDPK-VAVIMS 319
            ...: |.:.|..:...:.  :.:|:.::...||.. .|:.:|   |..|..:.::..: |..:.:
  Fly   228 GKESHYYQAKTEIRQFIRKIIERKLAEDEMGALPS-IQSNDK---NLFLNLVTDLMRRGVFTLKN 288

  Fly   320 LD-----ILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMP-TKDSLLNEENMKDMPYLR 378
            ::     |:|...:.||..:...|:.|:..|:.|.:..||:.:|.| |.|..::..:.:.|.||.
  Fly   289 VEDESNIIVFGAFETTANAVYYTLMLLAMFPEYQERAFEEIKTIFPNTGDFDVSYADTQQMVYLD 353

  Fly   379 AVIKETLRYYPNGLGTMRTCQNDVILS-GYRVPKGTTVLL-------GSNVLMKEATYYPRPDEF 435
            .::.|::|..|......|....|:.|| |..||||..:.:       ...:...:|..: .||.|
  Fly   354 LILNESMRVIPPVPVVSRQTSQDLKLSNGIVVPKGVQIAIDIYHMHRSKKIWGPDAETF-NPDHF 417

  Fly   436 LPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPF 500
            ||.. ::|..        |:.::||..|.|.|||.|...:..:.|:|||:||:..:    .|.||
  Fly   418 LPHN-IQDKH--------PYAYIPFTKGIRNCIGWRYALISAKVTLAKLLRNYRFK----TSFPF 469

  Fly   501 KTMFVMEPAITFPFK 515
            :.::.:|. ||...|
  Fly   470 ENLYFVED-ITMKLK 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 91/396 (23%)
Cyp313a4NP_650224.3 p450 33..465 CDD:299894 88/384 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.