DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and npp-24

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001379685.1 Gene:npp-24 / 3564830 WormBaseID:WBGene00022672 Length:655 Species:Caenorhabditis elegans


Alignment Length:362 Identity:77/362 - (21%)
Similarity:133/362 - (36%) Gaps:97/362 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LDSIVYFREHVRPDVYGEVQGLVASQ---NEAWGKLRSAINPIFMQPRGLRM-YYE-----PLSN 174
            |..:|.|     |:.:||.:.||..|   ..:.|..|...|.|    |.|:: .||     .|.:
 Worm   276 LSHLVVF-----PNEFGEFRFLVKDQLRLPSSNGDPRIVQNQI----RSLKVSRYEIATSSSLFS 331

  Fly   175 IN-NEFIERIKEIRDPKTLE------------VPEDFTDEISRLV----FESLGLVAFDRQMGLI 222
            :| ..:.|.:..|....|||            :|   :||:|...    ..:|..|:......|.
 Worm   332 VNIFPWFEALTSISPTSTLEKETRVSELVDAVIP---SDELSNTTKWTGARALRAVSVQLTQSLA 393

  Fly   223 RKNRDNSDALTLFQTSRDIFRLTF--KLDIQPSMWKIISTPTYRKMKRTLNDSL----NVAQKML 281
            .:..:      |...|.:|..|..  ..|.||:  .:.:..|:..:..|.|.:.    :|:|..:
 Worm   394 TEEEE------LLPESENIMHLVILENKDGQPA--HLFNISTFDNIWSTENKTSFGRDSVSQPPM 450

  Fly   282 KENQDALEKRRQAGEKINSNSMLERLMEIDPKVAVIMSLDI-LFAGVDATATLLSAVLLCLSKHP 345
            |                ::.|:.::|..:.|..|.::|..: ....:||......||...|.||.
 Worm   451 K----------------STGSLEQQLAALKPLAACVISEKVSCEEAIDAAMKFFDAVDERLKKHC 499

  Fly   346 DKQAKLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDV--ILSGYR 408
            :......|..|::..:..:|..::...|    :.:|:||     |.:..::...::.  .:.|.|
 Worm   500 EISKLFVERCLAVSSSAQALDEKQQSVD----QRLIEET-----NTVEELKIRMHETKERMEGAR 555

  Fly   409 VPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPE 445
              ||..||            :.|.||.:|   |.|.|
 Worm   556 --KGINVL------------FHRVDENVP---LSDNE 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 77/362 (21%)
npp-24NP_001379685.1 Nup88 26..>212 CDD:401976
Smc <455..>653 CDD:224117 33/147 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.