DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and CYP4A22

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:391 Identity:93/391 - (23%)
Similarity:159/391 - (40%) Gaps:65/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERIKEIRDPKTLEVPEDFTDEIS 203
            ||:....:.|.:.|..:.|.|.... |:.|...:::.....:::.:|:...   :.|.:....:|
Human   130 GLLLLNGQTWFQHRRMLTPAFHNDI-LKPYVGLMADSVRVMLDKWEELLGQ---DSPLEVFQHVS 190

  Fly   204 RLVFESLGLVAFDRQMGLIRKNRDN-------SDALTL--------FQTSRDIFRLTFKLDIQPS 253
            .:..:::...||..| |.|:.:|::       ||..:|        |..:..|:.||     ...
Human   191 LMTLDTIMKSAFSHQ-GSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLT-----SAG 249

  Fly   254 MWKIISTPTYR--KMKRTLNDSLNVAQKMLKENQDALEKRRQAGE----------KINSNSML-- 304
            .|      |:|  ::.....|.:...:|...:.:..|||.::...          |:.:.|:|  
Human   250 RW------THRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSD 308

  Fly   305 -ERLMEIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNE 368
             :...|:|         ..:|.|.|.||:.:|.:|..|:.||..|.:.|||:..::....| :..
Human   309 KDLRAEVD---------TFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGAS-ITW 363

  Fly   369 ENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVIL-SGYRVPKGTTVLLGSNVLMKEATYYPRP 432
            .::..|||....|||.||.||...|..|.....|.. .|..:|||..|||....|......:|..
Human   364 NHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNL 428

  Fly   433 DEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDAS 497
            :.|.|.|:.  |.:.:...    .||||..|.|.||||:....:::  ||:.:.....|...|.:
Human   429 EVFDPSRFA--PGSAQHSH----AFLPFSGGSRNCIGKQFAMNQLK--VARALTLLRFELLPDPT 485

  Fly   498 R 498
            |
Human   486 R 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 93/391 (24%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 93/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.