DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and CYP4Z1

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:387 Identity:94/387 - (24%)
Similarity:162/387 - (41%) Gaps:52/387 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QGLVASQNEAWGKLRSAINP--------IFMQPRGLRMYYEPLSNINNEFIERIKEIRDPKTLEV 194
            :|||......|.|.|..:.|        ||     :.|..|.:..:.|::.|.|.:   ...||:
Human   123 RGLVTLDGSKWKKHRQIVKPGFNISILKIF-----ITMMSESVRMMLNKWEEHIAQ---NSRLEL 179

  Fly   195 PEDFT----DEISRLVFESLGLVAFDRQM-----GLIRKNRDNSDALTLFQTSRDIFRLTFKLDI 250
            .:..:    |.|.:..|...|.:..|..:     .:...::.::..:..|....|   |.||...
Human   180 FQHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRMNNFLHHND---LVFKFSS 241

  Fly   251 QPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRR-------QAGEKINSNSMLERLM 308
            |..::...:...::..::.:.|.....:..||  ||..:|||       .:.:..|:....|..:
Human   242 QGQIFSKFNQELHQFTEKVIQDRKESLKDKLK--QDTTQKRRWDFLDILLSAKSENTKDFSEADL 304

  Fly   309 EIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMKD 373
            :.:.|.       .:|||.|.|::.:|.:|.||:|:|:.|.:.|:|:..::....| :..|::..
Human   305 QAEVKT-------FMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGDGSS-ITWEHLSQ 361

  Fly   374 MPYLRAVIKETLRYYPNGLGTMRTCQNDVIL-SGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLP 437
            |||....|||.||.|...:...|.....:.. .|..:|.|.||.:....|.....::..|..|.|
Human   362 MPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQVFNP 426

  Fly   438 ERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRP 499
            .|:.|  |..:|  :.|:.|:||..|.|.|||:....:|.:..||..:..|  :...|.|||
Human   427 LRFSR--ENSEK--IHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRF--KLAPDHSRP 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 94/387 (24%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 94/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.