DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-p and CYP11B1

DIOPT Version :9

Sequence 1:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_000488.3 Gene:CYP11B1 / 1584 HGNCID:2591 Length:503 Species:Homo sapiens


Alignment Length:429 Identity:111/429 - (25%)
Similarity:192/429 - (44%) Gaps:44/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KDIEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGL 165
            :|:|.:.:.:.:.|.|..|:..|.:|:|     .|...|:.......|...|..:||..:.|..:
Human    95 EDVEKLQQVDSLHPHRMSLEPWVAYRQH-----RGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAV 154

  Fly   166 RMYYEPLSNINNEFIERIKE-----IRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKN 225
            :.:...:..:..:|.:.:|:     .|...||:|    ...|.....|:..|..|..::||: .:
Human   155 QRFLPMVDAVARDFSQALKKKVLQNARGSLTLDV----QPSIFHYTIEASNLALFGERLGLV-GH 214

  Fly   226 RDNSDALTLFQTSRDIFRLTFKLDIQP---SMWKIISTPTYRKMKRTLNDSL-----NVAQKMLK 282
            ..:|.:|........:|:.|.:|...|   |.|   ::|...|......|.:     |..||:. 
Human   215 SPSSASLNFLHALEVMFKSTVQLMFMPRSLSRW---TSPKVWKEHFEAWDCIFQYGDNCIQKIY- 275

  Fly   283 ENQDALEKRRQAGEKINSNSMLERLMEIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDK 347
              |:....|.|....|.:..:|.  .|:.|......|:::....||.|...|...|..|:::|:.
Human   276 --QELAFSRPQQYTSIVAELLLN--AELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNV 336

  Fly   348 QAKLREELLSIMPTKDSLLNEENMK---DMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRV 409
            |..||:|.|:...:    ::|...|   ::|.|||.:|||||.||.||...|...:|::|..|.:
Human   337 QQALRQESLAAAAS----ISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHI 397

  Fly   410 PKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVD 474
            |.||.|.:....|.:....:|||:.:.|:|||....:|:.     |..:|||||.|.|:|:|:.:
Human   398 PAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRN-----FYHVPFGFGMRQCLGRRLAE 457

  Fly   475 LEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFP 513
            .||...:..::::..||............|::.|:: ||
Human   458 AEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSM-FP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 108/422 (26%)
CYP11B1NP_000488.3 p450 42..454 CDD:365848 102/385 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.