DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG42537

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster


Alignment Length:61 Identity:12/61 - (19%)
Similarity:20/61 - (32%) Gaps:23/61 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GKFCANT---DKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVR 171
            |:.|..|   :.::|...|.        |.||            :..:||..|..:...:|
  Fly    43 GRHCRRTAMDEMWYYNQRTR--------KCLK------------MKYLGCGGNQNRYCSLR 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 12/61 (20%)
CG42537NP_001163530.1 KU <53..89 CDD:294074 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.