DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Crispld1

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_113579.2 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:187 Identity:41/187 - (21%)
Similarity:69/187 - (36%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQC-DETG----------KFCAN 119
            ||...|.||:.|      |..|:.|..|.||.||:|.|:.....| .|.|          ...|:
Mouse    65 ILDLHNKLRSQV------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPASLLPSIGQNLGAH 123

  Fly   120 TDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVR-EGTCVGHYMPLI 183
            ..:|. ..|..:::.....:.......::..|               ..|.| .|....||..::
Mouse   124 WGRYR-PPTFHVQAWYDEVRDFSYPYENECDP---------------YCPFRCSGPVCTHYTQVV 172

  Fly   184 QDHGSRMGC------GLRVKGRDEKESNIILLCHFS-RASVNNLVPYEEGQIPAGKC 233
            ....||:||      .:.:.|:...:: :.|:|::| :.:.....||:.|: |...|
Mouse   173 WATSSRIGCAVNLCHNMNIWGQIWPKA-VYLVCNYSPKGNWWGHAPYKHGR-PCSAC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 35/164 (21%)
Crispld1NP_113579.2 CAP_CRISPLD1 62..207 CDD:349407 35/164 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.