DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CRISPLD1

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:208 Identity:46/208 - (22%)
Similarity:75/208 - (36%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQ 109
            :.:|.||..:..|.    ...||...|.||:.|      |..|:.|..|.||.||:|.|:.....
Human    48 IAKQRGKRAITDND----MQSILDLHNKLRSQV------YPTASNMEYMTWDVELERSAESWAES 102

  Fly   110 C-DETG----------KFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMN 163
            | .|.|          ...|:..:|. ..|..::|.....|........:..|            
Human   103 CLWEHGPASLLPSIGQNLGAHWGRYR-PPTFHVQSWYDEVKDFSYPYEHECNP------------ 154

  Fly   164 SQKLVPVR-EGTCVGHYMPLIQDHGSRMGC------GLRVKGRDEKESNIILLCHFS-RASVNNL 220
               ..|.| .|....||..::....:|:||      .:.:.|:...:: :.|:|::| :.:....
Human   155 ---YCPFRCSGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQIWPKA-VYLVCNYSPKGNWWGH 215

  Fly   221 VPYEEGQIPAGKC 233
            .||:.|: |...|
Human   216 APYKHGR-PCSAC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 36/167 (22%)
CRISPLD1NP_113649.1 CAP_CRISPLD1 62..207 CDD:349407 36/167 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.