DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and AT5G02730

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:161 Identity:33/161 - (20%)
Similarity:60/161 - (37%) Gaps:45/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VASGVGNYSVAARMPTMGWDFELQRLADRQVRQ----CDET---GKFCANTDKYHYVATTEIRSK 134
            ||||..|         :.||..|.|.|.:..:|    |..|   |.:..|..:|.       ||:
plant    69 VASGASN---------LRWDQGLARFASKWAKQRKSDCKMTHSGGPYGENIFRYQ-------RSE 117

  Fly   135 MGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLV-PVREGTCVGHYMPLIQDHGSRMGCGLRVKG 198
            ....:    .::||.:.|        .:|..::. ..:.|...|||..::....:.:||   .:.
plant   118 NWSPR----RVVDKWMDE--------SLNYDRVANTCKSGAMCGHYTQIVWRTTTAVGC---ARS 167

  Fly   199 RDEKESNIILLCHFSRASVNNLVPYEEGQIP 229
            :.:.....:::|.:|.:.      ..||:.|
plant   168 KCDNNRGFLVICEYSPSG------NYEGESP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 29/143 (20%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.