DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and AT4G31470

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:57 Identity:16/57 - (28%)
Similarity:26/57 - (45%) Gaps:11/57 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPYEEGQIP 229
            |.|: ||..|:....||:||.:...    |..:..::|::.  ...|:|    ||.|
plant   139 GDCL-HYTQLVWKKSSRIGCAISFC----KTGDTFIICNYD--PPGNIV----GQPP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 11/39 (28%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 16/57 (28%)

Return to query results.
Submit another query.