DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and AT4G25790

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_194309.1 Gene:AT4G25790 / 828684 AraportID:AT4G25790 Length:210 Species:Arabidopsis thaliana


Alignment Length:151 Identity:31/151 - (20%)
Similarity:52/151 - (34%) Gaps:48/151 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQ----CD---ETGKFCAN------TDKYHYV 126
            |.|..|:|       :|.:.||.::...|.....|    |.   .||.:..|      :|   :.
plant    83 NTVRGGLG-------LPPLVWDVKIASYATWWANQRRYDCSLTHSTGPYGENLFWGSGSD---FT 137

  Fly   127 ATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMG 191
            :|..:.|.....||...                 |.|:.:    .:|.| |||..::.....|:|
plant   138 STFAVESWTVEAKSYNH-----------------MTNTCE----GDGMC-GHYTQIVWRETRRLG 180

  Fly   192 CGLRVKGRDEKESNIILLCHF 212
            |...|   .|..:.:.:.|::
plant   181 CARVV---CENGAGVFITCNY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/151 (21%)
AT4G25790NP_194309.1 CAP_PR-1 76..210 CDD:349400 31/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.