DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and AT4G25780

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_194308.1 Gene:AT4G25780 / 828683 AraportID:AT4G25780 Length:190 Species:Arabidopsis thaliana


Alignment Length:243 Identity:48/243 - (19%)
Similarity:70/243 - (28%) Gaps:96/243 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMWYLYLFL----------LPLTASLIPEDDP------HCKPNLCMNSEIHVGCFQPKAVGEQC 49
            |...||.:.|          |.:|.|||.:...      .|| |||..                |
plant     1 MSSSYLRVILLLGALNVVVSLSITNSLITKSATLGQVFRICK-NLCPG----------------C 48

  Fly    50 GKNNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARM-PTMGWDFEL---------QRLAD 104
            ..::|          ..|.|.|::|            |||. |.:.||..|         ||..|
plant    49 DHDSL----------QFLFRHNLVR------------AARFEPPLIWDRRLQNYAQGWANQRRGD 91

  Fly   105 RQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVP 169
            ..:|.....|:|....:.|           .|...:...|           |.:....:.::...
plant    92 CALRHSVSNGEFNLGENIY-----------WGYGANWSPA-----------DAVVAWASEKRFYH 134

  Fly   170 VREGTC-----VGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHF 212
            ....||     .|||..::.....|:||...|.    ....|.:.|::
plant   135 YGSNTCDAGQMCGHYTQIVWKSTRRVGCARVVC----DNGGIFMTCNY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 32/165 (19%)
AT4G25780NP_194308.1 CAP_PR-1 54..190 CDD:349400 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.