DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and PR-1-LIKE

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:41 Identity:11/41 - (26%)
Similarity:20/41 - (48%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 EGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHF 212
            :|.| |||..::.....|:||   ...|.:.:..|.::|.:
plant   128 DGVC-GHYTQIVWRDSVRLGC---ASVRCKNDEYIWVICSY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 11/41 (27%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 11/41 (27%)

Return to query results.
Submit another query.