DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and AT2G19980

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:49 Identity:12/49 - (24%)
Similarity:24/49 - (48%) Gaps:5/49 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 GHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVN--NLVPY 223
            |||..::.:..:.:|||   ..|..|...:.::|:::...:.  |..||
plant   120 GHYTQIVANQSTHLGCG---TVRCFKNEYVWVVCNYAPRPMGDANTRPY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 9/35 (26%)
AT2G19980NP_179588.1 CAP_PR-1 35..165 CDD:349400 10/47 (21%)

Return to query results.
Submit another query.