DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and PR1

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:51 Identity:16/51 - (31%)
Similarity:21/51 - (41%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPY 223
            |.| |||..::.....|:||   .|.|......||...:..|.:..|..||
plant   115 GVC-GHYTQVVWRKSVRLGC---AKVRCNNGGTIISCNYDPRGNYVNEKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 12/39 (31%)
PR1NP_179068.1 CAP_PR-1 30..161 CDD:349400 14/49 (29%)

Return to query results.
Submit another query.