DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and PRB1

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:51 Identity:15/51 - (29%)
Similarity:21/51 - (41%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPY 223
            |.| |||..::..:..|:||   .|.|......||...:....:..|..||
plant   115 GVC-GHYTQVVWRNSVRLGC---AKVRCNNGGTIISCNYDPPGNYANQKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 12/39 (31%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.