DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Crisp4

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:298 Identity:57/298 - (19%)
Similarity:92/298 - (30%) Gaps:99/298 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PEDDPHCKPN---LCMN-SEIHVGCFQPKAVG----------------------------EQCGK 51
            |||  .|.|:   ||:: |..|:|...|.:|.                            ::...
Mouse    11 PED--RCPPSPGALCLSISSGHLGSRTPPSVFCTGMAVKFILLLFVAAFVPVVTIRPLKLDRALY 73

  Fly    52 NNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDET--- 113
            |.|........:..|::..|..|..|:....|      |..:.|.......|....|.||::   
Mouse    74 NKLITESQTEPQEEIVNTHNAFRRKVSPPARN------MLKVSWSSAAAENARILARYCDKSDSD 132

  Fly   114 -------GKFCA-NTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPV 170
                   ..||. |....||                         |..:..|:....|..|....
Mouse   133 SLERRLPNTFCGENMLMEHY-------------------------PSSWSKVIEIWFNESKYFKY 172

  Fly   171 REGTC------VGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHF-----SRASVNNLVPYE 224
            .|...      ..||..::......:||.: ...|.:|.:..:.:||:     .:.::|  :||:
Mouse   173 GEWPSTDDDIETDHYTQMVWASTYLVGCDV-AACRRQKAATYLYVCHYCHEGNHQDTLN--MPYK 234

  Fly   225 EGQIPAGKCATGPSQMYQFLCSE-----DEYVDANSMV 257
            ||. |...|   |:.....||:.     |||.:.::.|
Mouse   235 EGS-PCDDC---PNNCEDGLCTNPCIYYDEYNNCDTQV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 29/171 (17%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.