DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Glipr1

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:205 Identity:41/205 - (20%)
Similarity:78/205 - (38%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKY-----HYVATTE 130
            |.||:.|:....|      |..|.||.:|.::|....:.|:    |..|...:     ::.|..|
Mouse    42 NQLRSKVSPPARN------MLYMSWDPKLAQIAKAWTKSCE----FKHNPQLHSRIHPNFTALGE 96

  Fly   131 IRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLR 195
             ...:|   ||....:...:...:.::.....:::|...|    | |||..::.....::||.::
Mouse    97 -NIWLG---SLSIFSVSSAISAWYEEIKHYDFSTRKCRHV----C-GHYTQVVWADSYKLGCAVQ 152

  Fly   196 V--KGRDEKESNIILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVDANSMVV 258
            :  .|.:       .:|.:..|......||::|    ..|:.         |.:|:.. .||:.:
Mouse   153 LCPNGAN-------FICDYGPAGNYPTWPYKQG----ATCSD---------CPKDDKC-LNSLCI 196

  Fly   259 ESNMPSSDQI 268
            .   |..||:
Mouse   197 N---PRRDQV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 29/148 (20%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.