DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CRISP2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:253 Identity:54/253 - (21%)
Similarity:83/253 - (32%) Gaps:79/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GKNNLF---LNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCD 111
            ||:..|   |.....::..|:::.|.||..|:....|      |..|.|..|:...|.|...:|.
Human    21 GKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASN------MLKMEWSREVTTNAQRWANKCT 79

  Fly   112 ---------ETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKL 167
                     :|...|..    :...:::..|.....:|....|||      |:..:|        
Human    80 LQHSDPEDRKTSTRCGE----NLYMSSDPTSWSSAIQSWYDEILD------FVYGVG-------- 126

  Fly   168 VPVREGTCVGHYMPLIQDHGSRMGCGL-------------------RVKGRDEKESNI------I 207
             |......||||..|:.....::|||:                   .:|....|...|      :
Human   127 -PKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAMKTYLNKREGINVWKCFL 190

  Fly   208 LLCHFS--------RASVNNL----VPYEEGQIPAGKCATGPSQMYQFLCSED-EYVD 252
            .|.||.        ..|.||:    .||::|.    .||..|....:.||:.. :|.|
Human   191 RLRHFQLLRGEQLLTFSGNNMNRKNTPYQQGT----PCAGCPDDCDKGLCTNSCQYQD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 36/183 (20%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 31/161 (19%)
Crisp 224..278 CDD:285731 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.