DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:244 Identity:56/244 - (22%)
Similarity:89/244 - (36%) Gaps:75/244 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KMWYLYLFLLPLTASLIP----EDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGAL 62
            |:.:|:..:|.|.||.:|    :|.|.. |.:.          .||.:       :.|||::   
Mouse     6 KLNFLWTLVLYLIASRLPKAFGKDLPRV-PTIT----------DPKFI-------DAFLNIH--- 49

  Fly    63 KTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCAN-----TDK 122
                    |.||..|      ...||.|..:.||.:|.:||....|:|......|..     .:.
Mouse    50 --------NELRRKV------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLED 100

  Fly   123 YHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTC---VGHYMPLIQ 184
            |.::..   ...:||.::         .||   ||:....|..|.......||   .|||..::.
Mouse   101 YDFIGE---NIYLGRIET---------QPE---DVVINWYNESKYFNFDFNTCSEMCGHYTQVVW 150

  Fly   185 DHGSRMGCGL----RVKGRDEKESNIILLCHFSRASVNNLV---PYEEG 226
            ....::||.:    .:||    .|..:.:|::|.|  .|.:   ||..|
Mouse   151 AKTVKIGCAVSNCPNLKG----FSAGLFVCNYSPA--GNFIGFRPYTRG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 35/161 (22%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 40/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.