DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Glipr1l2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:211 Identity:46/211 - (21%)
Similarity:72/211 - (34%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 INMLRNYVASGVGN------YSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANT--DKYH-- 124
            ::.:..||  |:.|      :.....:..|.||..|.|.|....::|    .:..||  ||.|  
Mouse    48 VDFINEYV--GLHNELRGTVFPPGVNLRFMTWDVALSRTARAWGKKC----MYSRNTHLDKLHES 106

  Fly   125 ------------------YVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVR 171
                              :..||.|||.....||..           :|:               
Mouse   107 HPVFTEIGENMWVGPVEDFTVTTAIRSWHEERKSYS-----------YLN--------------- 145

  Fly   172 EGTCV-----GHYMPLIQDHGSRMGCGLRVKGRDEKESNIIL-LCHFSRASVNNLVPYEEGQIPA 230
             .|||     .||:.|:.|...::||.:....|....::..| :|:::........||:.||. .
Mouse   146 -DTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGGFTHAALFICNYAPGGTLTRRPYQAGQF-C 208

  Fly   231 GKCATGPSQMYQFLCS 246
            .:|..| .|...:|||
Mouse   209 SRCGPG-DQCTDYLCS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 36/176 (20%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 36/177 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.