DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Crisp3

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:212 Identity:46/212 - (21%)
Similarity:76/212 - (35%) Gaps:39/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVA-SGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATT 129
            |:::.|.||..|: ||       :.:..:.||.:....|.:...:|     ...::...|...|.
  Rat    44 IINKHNQLRRTVSPSG-------SDLLRVEWDHDAYVNAQKWANRC-----IYNHSPLQHRTTTL 96

  Fly   130 EIRSK--MGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGC 192
            :....  |....:..|:::.....|....|.|       ..|.:.|..||||..::.:....:.|
  Rat    97 KCGENLFMANYPASWSSVIQDWYDESLDFVFG-------FGPKKVGVKVGHYTQVVWNSTFLVAC 154

  Fly   193 GLRVKGRDEKESNIILLCHFSRAS--VNNLV-PYEEGQIPAGKCATGPSQMYQFLCS-----EDE 249
            |  |....::......:||:....  |..|. ||.||: |...|   |......||:     ||.
  Rat   155 G--VAECPDQPLKYFYVCHYCPGGNYVGRLYSPYTEGE-PCDSC---PGNCEDGLCTNSCEYEDN 213

  Fly   250 YVDANSMVVESNMPSSD 266
            |.:...:   ..|.|.|
  Rat   214 YSNCGDL---KKMVSCD 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 29/149 (19%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 29/150 (19%)
Crisp 192..246 CDD:285731 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.