DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and r3hdml

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:209 Identity:48/209 - (22%)
Similarity:87/209 - (41%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCD-ETGKFCANTD 121
            ::|...|.:|...|.:|:.|      :..||.|..|.||..|.:.|:....||. |.|       
Zfish    61 ISGKDMTALLDYHNRVRSQV------FPPAANMEYMVWDERLAKSAEFWASQCIWEHG------- 112

  Fly   122 KYHYVATTEIRSKM----GRTKSLKSAILDKLLPELFLDVMGCMMNSQK--LVPVR-EGTCVGHY 179
            .:|::  ..|...:    ||.||:             :|::....:.:.  ..|.| .|:...||
Zfish   113 PHHFL--QHIGQNLSIISGRYKSI-------------IDLVKSWYDERHSFSYPSRCSGSVCTHY 162

  Fly   180 MPLIQDHGSRMGCGLR------VKGRDEKESNIILLCHFSRASVNNLV---PYEEGQIPAGKCAT 235
            ..::....:::||.::      |.|...|::. :|:|::  |...|.|   ||:.|:    .|:.
Zfish   163 TQMVWAASNKIGCAIKKCSDIFVFGSMWKQAT-LLVCNY--AIKGNWVGEAPYKIGR----PCSA 220

  Fly   236 GPSQMYQFLCSEDE 249
            .||. |...|::::
Zfish   221 CPSS-YGGSCNKNQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 36/163 (22%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 36/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.