DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Glipr1l3

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:262 Identity:55/262 - (20%)
Similarity:91/262 - (34%) Gaps:81/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MWYLYLFLLPLTASLIPE----DDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALK 63
            :|.|.|:|:   |:.:|:    |.|.. |::          ..||.:       :.|||::    
Mouse    10 LWTLALYLI---ATRLPKAFGNDLPRV-PSI----------LDPKFI-------DAFLNIH---- 49

  Fly    64 TGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTD-----KY 123
                   |.||..|      ...||.|..:.||.:|.:||....|:|......|.:..     .|
Mouse    50 -------NELRRKV------QPPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDY 101

  Fly   124 HYVATT----EIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTC---VGHYMP 181
            .::...    ||.::                ||   ||:....|........:.||   ..:|..
Mouse   102 DFIGENIYLGEIETQ----------------PE---DVVNNWYNENTDYNFVDNTCSKICRNYTQ 147

  Fly   182 LIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLV---PYEEGQIPAGKCATGPSQMYQF 243
            |:.....::||.:.......:.|..:.:|::|  ...|.:   ||.:|. |...|  |..:....
Mouse   148 LVWAKTFKIGCAVSNCPNLTRYSAGLFVCNYS--PTGNFLDFRPYRKGD-PCSMC--GQRKCENS 207

  Fly   244 LC 245
            ||
Mouse   208 LC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/161 (19%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 36/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.