powered by:
Protein Alignment antr and im:7150988
DIOPT Version :9
Sequence 1: | NP_001246284.1 |
Gene: | antr / 246647 |
FlyBaseID: | FBgn0050488 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002667823.1 |
Gene: | im:7150988 / 504039 |
ZFINID: | ZDB-GENE-050309-169 |
Length: | 150 |
Species: | Danio rerio |
Alignment Length: | 54 |
Identity: | 11/54 - (20%) |
Similarity: | 24/54 - (44%) |
Gaps: | 6/54 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 GHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRA-SVNNLVPYEEGQIP 229
||:..::......:|.||...| :.:.::..:..| ::.|...||:..:|
Zfish 99 GHFTQVVWKSSKELGVGLATDG-----NTVFVVGQYKPAGNITNAGYYEQNVLP 147
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.