DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CLEC18B

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_047302585.1 Gene:CLEC18B / 497190 HGNCID:33849 Length:481 Species:Homo sapiens


Alignment Length:182 Identity:44/182 - (24%)
Similarity:71/182 - (39%) Gaps:47/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTE 130
            :||..|.||::|      ...||.|..:.|...|.:||..:...|.              :.|..
Human    51 LLSLHNRLRSWV------QPPAADMRRLDWSDSLAQLAQARAALCG--------------IPTPS 95

  Fly   131 IRSKMGRTKSLKSAILDKLLP---ELFLDVMGCMMNSQKLVP------VREGTCVGHY-----MP 181
            :.|.:.||  |:.....:|||   ..|::|:.......:...      .|..||. ||     :.
Human    96 LASGLWRT--LQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCT-HYTQVSVLQ 157

  Fly   182 LIQDHGSRMGCG--LRVKGRDEKESNIILLCHFSRA---SVN--NLVPYEEG 226
            |:....|::|||  |...|:...|:   .:|.:|..   .||  .::||::|
Human   158 LVWATSSQLGCGRHLCSAGQTAIEA---FVCAYSPGGNWEVNGKTIIPYKKG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 38/162 (23%)
CLEC18BXP_047302585.1 CAP_euk 50..188 CDD:349399 38/162 (23%)
EGF_CA 235..266 CDD:238011
CLECT 315..439 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.