DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Ag5r2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster


Alignment Length:274 Identity:66/274 - (24%)
Similarity:116/274 - (42%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTG 65
            ||:..|.:.::.|.   :.:...:|..::| |...|:.|.........|..:...:::|...|..
  Fly     1 MKLALLAILIVSLA---LAQATDYCSSDIC-NGGSHIACGHSNWWDSSCPGDAELIDINDDYKWV 61

  Fly    66 ILSRINMLRNYVASGV-GNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATT 129
            .:...|..|||:|.|. .|::.|.||.||.||.||..||...||||:.....|.|||.:.|    
  Fly    62 FVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKY---- 122

  Fly   130 EIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVRE------------------GTCV 176
                 .|:..:.::...|  ||:     ||.::::...:...|                  |..:
  Fly   123 -----SGQNLAWQAYSGD--LPD-----MGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAI 175

  Fly   177 GHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMY 241
            ||:..::.:..:|:||......|| ..:.:::.|:::..::.....|......|..|.:|.:..:
  Fly   176 GHFTVMMSERNTRLGCAAARYNRD-GWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEF 239

  Fly   242 QFLCSEDEYVDANS 255
            ..|||..|:.|.||
  Fly   240 GNLCSTSEWYDVNS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 44/168 (26%)
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 43/165 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440610
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.