DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG8483

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:249 Identity:60/249 - (24%)
Similarity:87/249 - (34%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QPKA------------VGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASG-VGNYSVAARMPT 92
            ||.|            |...|....:...:....::.||...|.||..||:| ......|..|..
  Fly     3 QPSAVLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMRE 67

  Fly    93 MGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTKSL--KSAILD-------K 148
            :.||.||...|.          |:..|....|....|..|..||:..::  .:|.||       .
  Fly    68 IVWDDELAARAQ----------KWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPS 122

  Fly   149 LLPELFLDVMGCMMN---SQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLC 210
            .:...|.:|......   |.|         .|||..|:....|.:|||. .:.:|..:.|.:.:|
  Fly   123 RIQSWFNEVQKYSFGDAWSPK---------TGHYSQLVWGETSLVGCGY-AEYKDTSKYNKLYVC 177

  Fly   211 HFSRASVNNLV---PYEEGQIPAGKCATGPSQMYQFLCSEDEYVDANSMVVESN 261
            ::...  .|:|   |||.|:.........||..||.||:......|.:.|..:|
  Fly   178 NYGPG--GNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSPAANSVYGAN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 40/162 (25%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 40/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.