DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG11977

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:208 Identity:48/208 - (23%)
Similarity:85/208 - (40%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IPEDDP-HCKPNLCMNSEIHVGC-FQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASG 80
            ||...| :|..::|..::.|:.| |  |....:||:|:..:.::. .:..|:..:|..|..:..|
  Fly    37 IPVKPPDYCNADICPANKKHITCGF--KFWSTKCGRNHEGVRMSD-YRYDIVRNVNNFRRKLEWG 98

  Fly    81 VGNYSVAARMPTMGWDFELQRLADRQVRQC-DETGKFCANTDKYHYVATTEIRSKMGRTKSLKSA 144
            :||...|.:...:.||.||..:|.|...|| ..|...|.||..|..|..:....|:..|....:.
  Fly    99 LGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFNV 163

  Fly   145 I--------LDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDE 201
            |        ..|::...:::....:....:|:         .:..||.:...:||||:...|:..
  Fly   164 ISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLI---------IFANLIYEKNKKMGCGMVKSGQGR 219

  Fly   202 KESNIILLCHFSR 214
                 .|.|.|.:
  Fly   220 -----FLTCLFDK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 35/158 (22%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.