DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG6628

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:114/264 - (43%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVAS 79
            |:..|.|  :|:..||.:.:.|:.|.....:|:||..:...:|:.| |:..||...|.|||.:||
  Fly    24 ATAPPTD--YCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTG-LQDLILGEHNALRNVLAS 85

  Fly    80 G-VGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKS 143
            | :.|.....||.|:.|..||..||...|:||......|.||..:|         ..|:..:|.:
  Fly    86 GKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFH---------NSGQNLALVN 141

  Fly   144 AILDKLLPE--------LFLDVMGCMMNS---------QKLVPVREGTCVGHYMPLIQDHGSRMG 191
            .   .||||        |..:.:|...|.         |:....:.|..:.::..:.:|:.:.:|
  Fly   142 I---TLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVG 203

  Fly   192 CGLRVKGRDEKESN---IILLCHFSRASVNNLVP----YEEGQIPAGKCATGPSQMYQFLC-SED 248
            |...   |.||.:.   .:|.|:::    :|.||    |:|..|   .|.:|....|..|| :.:
  Fly   204 CAAL---RFEKPAGHPLFLLACNYA----SNYVPDWPIYKEKAI---GCQSGSDLKYPSLCKAGE 258

  Fly   249 EYVD 252
            ||.|
  Fly   259 EYQD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 44/170 (26%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 44/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440694
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.